CDS

Accession Number TCMCG073C03753
gbkey CDS
Protein Id XP_010521445.1
Location complement(join(1581477..1581527,1581678..1581739,1582347..1582402,1582677..1582768,1582834..1582923))
Gene LOC104800345
GeneID 104800345
Organism Tarenaya hassleriana

Protein

Length 116aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA268022
db_source XM_010523143.1
Definition PREDICTED: transcription elongation factor SPT4 homolog 2-like [Tarenaya hassleriana]

EGGNOG-MAPPER Annotation

COG_category K
Description May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03019        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
KEGG_ko ko:K15171        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000993        [VIEW IN EMBL-EBI]
GO:0001098        [VIEW IN EMBL-EBI]
GO:0001099        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003700        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003727        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006325        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006397        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008023        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019899        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032044        [VIEW IN EMBL-EBI]
GO:0032784        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034243        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070063        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGAAGCGCGCCGGCACAGATTCCGACGAGCTTCGGTCACGAGCTTAGGTCTTGTCTCCGTTGCCGTCTTGTGAAGACCTACGACCAGTTCAGAGAATCGGGGTGTGAGAATTGCCCTTTCTTCAAGATGGATGACGACCATGAGCGTATTGTGGATTGCACCACGCCTAACTTCAACGGAATAATCTCGGTGATGGATCCAAGCAGAAGCTGGGCCGCGAGGTGGTTAAGAATAGGGAAGTTTGTTCCGGGTTGCTACACTCTTGCTGTCTCAGAGGCACTGTCAGAAGATTTGCAGATCCTATGCCAAGAAGAACGCGTGCAATATGTACAGCCAAAACGCATATGA
Protein:  
MGSAPAQIPTSFGHELRSCLRCRLVKTYDQFRESGCENCPFFKMDDDHERIVDCTTPNFNGIISVMDPSRSWAARWLRIGKFVPGCYTLAVSEALSEDLQILCQEERVQYVQPKRI